PDB entry 1gcw

View 1gcw on RCSB PDB site
Description: CO form hemoglobin from mustelus griseus
Deposited on 2000-08-08, released 2000-09-06
The last revision prior to the SCOP 1.63 freeze date was dated 2001-04-11, with a file datestamp of 2001-04-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1gcwa_
  • Chain 'B':
    Domains in SCOP 1.63: d1gcwb_
  • Chain 'C':
    Domains in SCOP 1.63: d1gcwc_
  • Chain 'D':
    Domains in SCOP 1.63: d1gcwd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcwA (A:)
    aftacekqtigkiaqvlakspeaygaeclarlfvthpgsksyfeykdysaagakvqvhgg
    kviravvkaaehvddlhshletlalthgkkllvdpqnfpmlseciivtlathltefspdt
    hcavdkllsaicqelssryr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gcwB (B:)
    vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqkrtdfrssihagivvga
    lqdavkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiw
    dkffevvidaisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gcwB (B:)
    vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqfrssihagivvgalqda
    vkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiwdkff
    evvidaisk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcwC (C:)
    aftacekqtigkiaqvlakspeaygaeclarlfvthpgsksyfeykdysaagakvqvhgg
    kviravvkaaehvddlhshletlalthgkkllvdpqnfpmlseciivtlathltefspdt
    hcavdkllsaicqelssryr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gcwD (D:)
    vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqkrtdfrssihagivvga
    lqdavkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiw
    dkffevvidaisk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gcwD (D:)
    vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqfrssihagivvgalqda
    vkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiwdkff
    evvidaisk