PDB entry 1gcv

View 1gcv on RCSB PDB site
Description: deoxy form hemoglobin from mustelus griseus
Deposited on 2000-08-08, released 2000-04-11
The last revision prior to the SCOP 1.63 freeze date was dated 2000-04-25, with a file datestamp of 2000-04-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.181
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1gcva_
  • Chain 'B':
    Domains in SCOP 1.63: d1gcvb_
  • Chain 'C':
    Domains in SCOP 1.63: d1gcvc_
  • Chain 'D':
    Domains in SCOP 1.63: d1gcvd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcvA (A:)
    aftacekqtigkiaqvlakspeaygaeclarlfvthpgsksyfeykdysaagakvqvhgg
    kviravvkaaehvddlhshletlalthgkkllvdpqnfpmlseciivtlathltefspdt
    hcavdkllsaicqelssryr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcvB (B:)
    vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqkrtdfrssihagivvga
    lqdavkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiw
    dkffevvidaiskqyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcvC (C:)
    aftacekqtigkiaqvlakspeaygaeclarlfvthpgsksyfeykdysaagakvqvhgg
    kviravvkaaehvddlhshletlalthgkkllvdpqnfpmlseciivtlathltefspdt
    hcavdkllsaicqelssryr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcvD (D:)
    vhwtqeerdeisktfqgtdmktvvtqaldrmfkvypwtnryfqkrtdfrssihagivvga
    lqdavkhmddvktlfkdlskkhaddlhvdpgsfhlltdciivelaylrkdcftphiqgiw
    dkffevvidaiskqyh