PDB entry 1gcs

View 1gcs on RCSB PDB site
Description: structure of the bovine gamma-b crystallin at 150k
Deposited on 1994-01-27, released 1994-04-30
The last revision prior to the SCOP 1.69 freeze date was dated 1994-04-30, with a file datestamp of 1994-04-29.
Experiment type: -
Resolution: 2 Å
R-factor: 0.17
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gcs_ (-)
gkitfyedrgfqghcyecssdcpnlqpyfsrcnsirvdsgcwmlyerpnyqghqyflrrg
dypdyqqwmgfndsirscrlipqhtgtfrmriyerddfrgqmseitddcpslqdrfhlte
vhslnvlegswvlyempsyrgrqyllrpgeyrryldwgamnakvgslrrvmdfy