PDB entry 1gcq

View 1gcq on RCSB PDB site
Description: crystal structure of vav and grb2 sh3 domains
Class: signaling protein/signaling protein
Keywords: SH3 domain, PROTEIN-PROTEIN COMPLEX, Grb2,Vav
Deposited on 2000-08-08, released 2001-08-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-01-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.68 Å
R-factor: 0.201
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62993 (2-End)
      • cloning artifact (1)
    Domains in SCOP 1.75: d1gcqa_
  • Chain 'B':
    Compound: Growth factor receptor-bound protein 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gcqb_
  • Chain 'C':
    Compound: vav proto-oncogene
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27870 (4-End)
      • cloning artifact (0-3)
    Domains in SCOP 1.75: d1gcqc_
  • Heterogens: MRD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gcqA (A:)
    gstyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnrn
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gcqA (A:)
    styvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gcqB (B:)
    gstyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnrn
    v
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gcqB (B:)
    tyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gcqC (C:)
    gshmpkmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwf
    pcnrvhpyvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gcqC (C:)
    gshmpkmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwf
    pcnrvhpyv