PDB entry 1gcp

View 1gcp on RCSB PDB site
Description: crystal structure of vav sh3 domain
Class: signaling protein
Keywords: sh3 domain,vav
Deposited on 2000-08-08, released 2001-08-08
The last revision prior to the SCOP 1.75 freeze date was dated 2003-01-28, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vav proto-oncogene
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gcpa_
  • Chain 'B':
    Compound: vav proto-oncogene
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27870 (4-69)
      • cloning artifact (3)
    Domains in SCOP 1.75: d1gcpb_
  • Chain 'C':
    Compound: vav proto-oncogene
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gcpc_
  • Chain 'D':
    Compound: vav proto-oncogene
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gcpd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gcpA (A:)
    gshmpkmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwf
    pcnrvhpyvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gcpA (A:)
    kmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcnrv
    hpyvh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gcpB (B:)
    gshmpkmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwf
    pcnrvhpyvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gcpB (B:)
    mpkmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcn
    rvhpyvh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gcpC (C:)
    gshmpkmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwf
    pcnrvhpyvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gcpC (C:)
    kmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcnrv
    hpyvh
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gcpD (D:)
    gshmpkmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwf
    pcnrvhpyvh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gcpD (D:)
    kmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcnrv
    hpyvh