PDB entry 1gcp

View 1gcp on RCSB PDB site
Description: crystal structure of vav sh3 domain
Deposited on 2000-08-08, released 2001-08-08
The last revision prior to the SCOP 1.57 freeze date was dated 2001-08-08, with a file datestamp of 2001-08-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.193
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1gcpa_
  • Chain 'B':
    Domains in SCOP 1.57: d1gcpb_
  • Chain 'C':
    Domains in SCOP 1.57: d1gcpc_
  • Chain 'D':
    Domains in SCOP 1.57: d1gcpd_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcpA (A:)
    kmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcnrv
    hpyvh
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcpB (B:)
    mpkmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcn
    rvhpyvh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcpC (C:)
    kmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcnrv
    hpyvh
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcpD (D:)
    kmevfqeyygippppgafgpflrlnpgdiveltkaeaehnwwegrntatnevgwfpcnrv
    hpyvh