PDB entry 1gco

View 1gco on RCSB PDB site
Description: crystal structure of glucose dehydrogenase complexed with nad+
Class: oxidoreductase
Keywords: short-chain dehydrogenase/reductase, oxidoreductase
Deposited on 2000-08-07, released 2001-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.178
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose dehydrogenase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gcoa_
  • Chain 'B':
    Compound: glucose dehydrogenase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gcob_
  • Chain 'E':
    Compound: glucose dehydrogenase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gcoe_
  • Chain 'F':
    Compound: glucose dehydrogenase
    Species: Bacillus megaterium [TaxId:1404]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gcof_
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcoA (A:)
    mykdlegkvvvitgsstglgksmairfatekakvvvnyrskedeansvleeikkvggeai
    avkgdvtvesdvinlvqsaikefgkldvminnaglenpvsshemslsdwnkvidtnltga
    flgsreaikyfvendikgtvinmssvhekipwplfvhyaaskggmklmtetlaleyapkg
    irvnnigpgaintpinaekfadpeqradvesmipmgyigepeeiaavaawlasseasyvt
    gitlfadggmtqypsfqagrg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcoB (B:)
    mykdlegkvvvitgsstglgksmairfatekakvvvnyrskedeansvleeikkvggeai
    avkgdvtvesdvinlvqsaikefgkldvminnaglenpvsshemslsdwnkvidtnltga
    flgsreaikyfvendikgtvinmssvhekipwplfvhyaaskggmklmtetlaleyapkg
    irvnnigpgaintpinaekfadpeqradvesmipmgyigepeeiaavaawlasseasyvt
    gitlfadggmtqypsfqagrg
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcoE (E:)
    mykdlegkvvvitgsstglgksmairfatekakvvvnyrskedeansvleeikkvggeai
    avkgdvtvesdvinlvqsaikefgkldvminnaglenpvsshemslsdwnkvidtnltga
    flgsreaikyfvendikgtvinmssvhekipwplfvhyaaskggmklmtetlaleyapkg
    irvnnigpgaintpinaekfadpeqradvesmipmgyigepeeiaavaawlasseasyvt
    gitlfadggmtqypsfqagrg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcoF (F:)
    mykdlegkvvvitgsstglgksmairfatekakvvvnyrskedeansvleeikkvggeai
    avkgdvtvesdvinlvqsaikefgkldvminnaglenpvsshemslsdwnkvidtnltga
    flgsreaikyfvendikgtvinmssvhekipwplfvhyaaskggmklmtetlaleyapkg
    irvnnigpgaintpinaekfadpeqradvesmipmgyigepeeiaavaawlasseasyvt
    gitlfadggmtqypsfqagrg