PDB entry 1gcj

View 1gcj on RCSB PDB site
Description: n-terminal fragment of importin-beta
Class: transport protein
Keywords: HEAT REPEAT MOTIF, NUCLEAR PORE-TARGETING COMPLEX COMPONENT, nuclear import factor, TRANSPORT PROTEIN
Deposited on 2000-07-31, released 2000-10-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.215
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: importin beta
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P70168 (6-454)
      • modified residue (6)
      • modified residue (151)
      • modified residue (186)
      • modified residue (224)
      • modified residue (250)
      • modified residue (257)
      • modified residue (261)
      • modified residue (273)
      • modified residue (296)
      • modified residue (358)
      • modified residue (393)
      • modified residue (415)
      • modified residue (422)
      • cloning artifact (455-459)
      • cloning artifact (0-5)
    Domains in SCOPe 2.06: d1gcja1, d1gcja2, d1gcja3
  • Chain 'B':
    Compound: importin beta
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P70168 (6-454)
      • modified residue (6)
      • modified residue (151)
      • modified residue (186)
      • modified residue (224)
      • modified residue (250)
      • modified residue (257)
      • modified residue (261)
      • modified residue (273)
      • modified residue (296)
      • modified residue (358)
      • modified residue (393)
      • modified residue (415)
      • modified residue (422)
      • cloning artifact (455-459)
      • cloning artifact (0-5)
    Domains in SCOPe 2.06: d1gcjb1, d1gcjb2, d1gcjb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcjA (A:)
    pdyasgmelitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvar
    vaaglqiknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcva
    giacaeipvsqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneil
    taiiqgmrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvr
    vaalqnlvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdla
    ieaseaaeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclml
    lstcceddivphvlpfikehiknpdwryrdaavmafgsilegpepnqlkplviqamptli
    elmkdpsvvvrdttawtvgricellpeaaindvylvpnss
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcjB (B:)
    pdyasgmelitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvar
    vaaglqiknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcva
    giacaeipvsqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneil
    taiiqgmrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvr
    vaalqnlvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdla
    ieaseaaeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclml
    lstcceddivphvlpfikehiknpdwryrdaavmafgsilegpepnqlkplviqamptli
    elmkdpsvvvrdttawtvgricellpeaaindvylvpnss