PDB entry 1gci

View 1gci on RCSB PDB site
Description: the 0.78 angstroms structure of a serine protease-bacillus lentus subtilisin
Class: serine protease
Keywords: subtilisin, bacillus lentus, hydrolase, serine protease
Deposited on 1998-09-02, released 1998-10-21
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 0.78 Å
R-factor: 0.099
AEROSPACI score: 1.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: subtilisin
    Species: Bacillus lentus [TaxId:1467]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1gcia_
  • Heterogens: SO4, CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gciA (A:)
    aqsvpwgisrvqapaahnrgltgsgvkvavldtgisthpdlnirggasfvpgepstqdgn
    ghgthvagtiaalnnsigvlgvapsaelyavkvlgasgsgsvssiaqglewagnngmhva
    nlslgspspsatleqavnsatsrgvlvvaasgnsgagsisyparyanamavgatdqnnnr
    asfsqygagldivapgvnvqstypgstyaslngtsmatphvagaaalvkqknpswsnvqi
    rnhlkntatslgstnlygsglvnaeaatr