PDB entry 1gcg

View 1gcg on RCSB PDB site
Description: the 1.9 angstroms x-ray structure of a closed unliganded form of the periplasmic glucose(slash)galactose receptor from salmonella typhimurium
Class: galactose-binding protein
Keywords: galactose-binding protein
Deposited on 1994-02-03, released 1994-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galactose/glucose-binding protein
    Species: Salmonella typhimurium [TaxId:602]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23905 (0-308)
      • conflict (151)
    Domains in SCOPe 2.07: d1gcga_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcgA (A:)
    adtrigvtiykyddnfmsvvrkaiekdgksapdvqllmndsqndqskqndqidvllakgv
    kalainlvdpaaagtviekargqnvpvvffnkepsrkaldsydkayyvgtdskesgviqg
    dliakhwqanqgwdlnkdgkiqyvllkgepghpdaearttyvvkelndkgiqteqlaldt
    amwdtaqakdkmdawlsgpnankievvianndamamgavealkahnkssipvfgvdalpe
    alalvksgamagtvlndannqakatfdlaknlaegkgaadgtswkienkivrvpyvgvdk
    dnlseftqk