PDB entry 1gcf

View 1gcf on RCSB PDB site
Description: nmr structure of the c-terminal domain of the ligand-binding region of murine granulocyte colony-stimulating factor receptor, 12 structures
Deposited on 1997-04-10, released 1997-10-22
The last revision prior to the SCOP 1.63 freeze date was dated 1997-10-22, with a file datestamp of 1997-10-22.
Experiment type: NMR12
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.63: d1gcf__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gcf_ (-)
    gssleppmlqaldigpdvvshqpgclwlswkpwkpseymeqecelryqpqlkganwtlvf
    hlpsskdqfelcglhqapvytlqmrcirsslpgfwspwspglqlrptmk