PDB entry 1gcc

View 1gcc on RCSB PDB site
Description: solution nmr structure of the complex of gcc-box binding domain of aterf1 and gcc-box DNA, minimized average structure
Class: transcription/DNA
Keywords: transcription factor, protein-DNA complex, ethylene inducible, complex (transcription factor/DNA), transcription/DNA complex
Deposited on 1998-03-13, released 1999-03-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ethylene responsive element binding factor 1
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: ATERF1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gcca_
  • Chain 'B':
    Compound: DNA (5'-d(*tp*ap*gp*cp*cp*gp*cp*cp*ap*gp*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(*gp*cp*tp*gp*gp*cp*gp*gp*cp*tp*a)-3')

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gccA (A:)
    khyrgvrqrpwgkfaaeirdpakngarvwlgtfetaedaalaydraafrmrgsrallnfp
    lrv
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.