PDB entry 1gc9

View 1gc9 on RCSB PDB site
Description: the crystal structure of thermus thermophilus 3-isopropylmalate dehydrogenase mutated at 172th from ala to gly
Class: oxidoreductase
Keywords: IPMDH, IMDH, Thermostability, dehydrogenation, decarboxylation, OXIDOREDUCTASE
Deposited on 2000-07-28, released 2000-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-isopropylmalate dehydrogenase
    Species: Thermus thermophilus [TaxId:300852]
    Gene: LEUB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SIY4 (0-344)
      • see remark 999 (84)
      • engineered (171)
    Domains in SCOPe 2.08: d1gc9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gc9A (A:)
mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafegarkrrkhv
vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
afglvelarkvedavakalletpppdlggsagteaftatvlrhla