PDB entry 1gc6

View 1gc6 on RCSB PDB site
Description: crystal structure of the radixin ferm domain complexed with inositol-(1,4,5)-triphosphate
Class: cell adhesion
Keywords: cytoskeleton,cell adhesion
Deposited on 2000-07-21, released 2000-09-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.229
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Radixin
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gc6a1, d1gc6a2, d1gc6a3
  • Heterogens: I3P

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gc6A (A:)
    mpkpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlk
    lnkkvtqqdvkkenplqfkfrakffpedvseeliqeitqrlfflqvkeailndeiycppe
    tavllasyavqakygdynkeihkpgylandrllpqrvleqhkltkeqweeriqnwheehr
    gmlredsmmeylkiaqdlemygvnyfeiknkkgtelwlgvdalglniyehddkltpkigf
    pwseirnisfndkkfvikpidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp