PDB entry 1gbt

View 1gbt on RCSB PDB site
Description: structure of an acyl-enzyme intermediate during catalysis: (guanidinobenzoyl) trypsin
Class: hydrolase(serine proteinase)
Keywords: hydrolase(serine proteinase)
Deposited on 1991-09-17, released 1994-01-31
The last revision prior to the SCOP 1.75 freeze date was dated 1994-01-31, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.162
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-trypsin
    Species: Bos taurus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1gbta_
  • Heterogens: CA, SO4, GBS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1gbtA (A:)
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn