PDB entry 1gba

View 1gba on RCSB PDB site
Description: alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by ala
Class: hydrolase (serine proteinase)
Keywords: active-site mutation, hydrolase (serine proteinase)
Deposited on 1995-09-06, released 1996-01-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.138
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-lytic protease
    Species: Lysobacter enzymogenes [TaxId:69]
    Gene: ALPHA-LYTIC PROTEASE PREPROENZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00778 (Start-197)
      • engineered (137)
      • engineered (160)
    Domains in SCOPe 2.08: d1gbaa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gbaA (A:)
    anivggieysinnaslcsvgfsvtrgatkgfvtaghcgtvnatariggavvgtfaarvfp
    gndrawvsltsaqtllprvangssfvtvrgsteaavgaavcrsgrttgyqcgtitaknvt
    anyaegavrgltqgnacagrgdsggswitsagqaqgvmsganvqsngnncgipasqrssl
    ferlqpilsqyglslvtg