PDB entry 1gb4

View 1gb4 on RCSB PDB site
Description: hyperthermophilic variant of the b1 domain from streptococcal protein g, nmr, 47 structures
Class: hyperthermophile
Keywords: hyperthermophile, streptococcal protein g
Deposited on 1998-01-19, released 1998-07-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gb1-c3b4
    Species: Streptococcus sp. [TaxId:1324]
    Gene: GB1C3B4
    Database cross-references and differences (RAF-indexed):
    • Uniprot P19909 (1-56)
      • engineered (3)
      • engineered (6)
      • engineered (16)
      • engineered (18)
      • engineered (25)
      • engineered (29)
      • engineered (39)
    Domains in SCOPe 2.07: d1gb4a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gb4A (A:)
    mttfkliingktlkgeitieavdaaeaekifkqyandngidgewtyddatktftvte