PDB entry 1gb1

View 1gb1 on RCSB PDB site
Description: a novel, highly stable fold of the immunoglobulin binding domain of streptococcal protein g
Class: immunoglobulin binding protein
Keywords: immunoglobulin binding protein
Deposited on 1991-05-15, released 1993-04-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-12.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein g
  Species: Streptomyces griseus [TaxId:1911]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P06654 (1-55)
  Domains in SCOPe 2.08: d1gb1a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gb1A (A:)
  mtyklilngktlkgettteavdaataekvfkqyandngvdgewtyddatktftvte