PDB entry 1gaz

View 1gaz on RCSB PDB site
Description: Crystal Structure of Mutant Human Lysozyme Substituted at the Surface Positions
Class: hydrolase
Keywords: surface mutant, HYDROLASE
Deposited on 2000-06-26, released 2000-07-27
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.168
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineerred (1)
    Domains in SCOPe 2.06: d1gaza_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gazA (A:)
    kifercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv