PDB entry 1gay

View 1gay on RCSB PDB site
Description: crystal structure of mutant human lysozyme substituted at the surface positions
Class: hydrolase
Keywords: surface mutant, HYDROLASE
Deposited on 2000-06-26, released 2000-06-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-03-14, with a file datestamp of 2018-03-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: mutant lysozyme
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61626 (0-129)
    • engineered mutation (1)
  Domains in SCOPe 2.08: d1gaya_
• Heterogens: NA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gayA (A:)
  kgfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
  srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv