PDB entry 1gau

View 1gau on RCSB PDB site
Description: solution structure of the specific DNA complex of the zinc containing DNA binding domain of the erythroid transcription factor gata-1 by multidimensional nmr
Class: transcription/DNA
Keywords: TRANSCRIPTION/DNA, TRANSCRIPTION-DNA complex
Deposited on 1993-06-28, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-09-05, with a file datestamp of 2012-08-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: erythroid transcription factor gata-1
  Species: Gallus gallus [TaxId:9031]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17678 (0-59)
  Domains in SCOPe 2.08: d1gaua_
• Chain 'B':
  Compound: DNA (5'-d(p*ap*gp*ap*tp*ap*ap*ap*c)-3')
  
• Chain 'C':
  Compound: DNA (5'-d(p*gp*tp*tp*tp*ap*tp*cp*t)-3')
  

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gauA (A:)
  kragtvcsncqtstttlwrrspmgdpvcnacglyyklhqvnrpltmrkdgiqtrnrkvss
  

  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  No sequence available.