PDB entry 1gar

View 1gar on RCSB PDB site
Description: towards structure-based drug design: crystal structure of a multisubstrate adduct complex of glycinamide ribonucleotide transformylase at 1.96 angstroms resolution
Deposited on 1994-12-08, released 1995-07-10
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.168
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1gara_
  • Chain 'B':
    Domains in SCOP 1.55: d1garb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1garA (A:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1garA (A:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrngdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplviswf
    adgrlkmhenaawldgqrlppqgya
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1garB (B:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpkypglht
    hrqalengdeehgtsvhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplv
    iswfadgrlkmhenaawldgqrlppqgya
    

    Sequence, based on observed residues (ATOM records): (download)
    >1garB (B:)
    mnivvlisgngsnlqaiidacktnkikgtvravfsnkadafglerarqagiathtliasa
    fdsreaydreliheidmyapdvvvlagfmrilspafvshyagrllnihpsllpdeehgts
    vhfvtdeldggpvilqakvpvfagdsedditarvqtqehaiyplviswfadgrlkmhena
    awldgqrlppqgya