PDB entry 1gaq

View 1gaq on RCSB PDB site
Description: crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase
Deposited on 2000-05-08, released 2001-02-07
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-07, with a file datestamp of 2001-02-07.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.232
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gaqA (A:)
    eskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipyregqsigv
    iadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkgvcsnflcd
    lqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglg
    wlflgvptsssllykeefgkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeel
    wellkkdntyvymcglkgmekgiddimvslaekdgidwfdykkqlkrgdqwnvevy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gaqB (B:)
    atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsd
    qsylddgqiadgwvltchayptsdvviethkeeeltga
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gaqC (C:)
    eskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipyregqsigv
    iadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkgvcsnflcd
    lqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglg
    wlflgvptsssllykeefgkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeel
    wellkkdntyvymcglkgmekgiddimvslaekdgidwfdykkqlkrgdqwnvevy