PDB entry 1gaq

View 1gaq on RCSB PDB site
Description: crystal structure of the complex between ferredoxin and ferredoxin-nadp+ reductase
Class: oxidoreductase/electron transport
Keywords: oxidoreductase/electron transport
Deposited on 2000-05-08, released 2001-02-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.59 Å
R-factor: 0.232
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin-nadp+ reductase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gaqa1, d1gaqa2
  • Chain 'B':
    Compound: ferredoxin I
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gaqb_
  • Chain 'C':
    Compound: ferredoxin-nadp+ reductase
    Species: Zea mays [TaxId:4577]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gaqc1, d1gaqc2
  • Heterogens: FAD, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gaqA (A:)
    iraqasaveapatakakkeskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhm
    vfstegkipyregqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliy
    tndageivkgvcsnflcdlqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsf
    lwkmffekhddykfnglgwlflgvptsssllykeefgkmkerapenfrvdyavsreqtna
    agermyiqtrmaeykeelwellkkdntyvymcglkgmekgiddimvslaekdgidwfdyk
    kqlkrgdqwnvevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gaqA (A:)
    eskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipyregqsigv
    iadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkgvcsnflcd
    lqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglg
    wlflgvptsssllykeefgkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeel
    wellkkdntyvymcglkgmekgiddimvslaekdgidwfdykkqlkrgdqwnvevy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gaqB (B:)
    atynvklitpegevelqvpddvyildqaeedgidlpyscragscsscagkvvsgsvdqsd
    qsylddgqiadgwvltchayptsdvviethkeeeltga
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gaqC (C:)
    iraqasaveapatakakkeskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhm
    vfstegkipyregqsigviadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliy
    tndageivkgvcsnflcdlqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsf
    lwkmffekhddykfnglgwlflgvptsssllykeefgkmkerapenfrvdyavsreqtna
    agermyiqtrmaeykeelwellkkdntyvymcglkgmekgiddimvslaekdgidwfdyk
    kqlkrgdqwnvevy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gaqC (C:)
    eskkqeegvvtnlykpkepyvgrcllntkitgddapgetwhmvfstegkipyregqsigv
    iadgvdkngkphkvrlysiassaigdfgdsktvslcvkrliytndageivkgvcsnflcd
    lqpgdnvqitgpvgkemlmpkdpnatiimlatgtgiapfrsflwkmffekhddykfnglg
    wlflgvptsssllykeefgkmkerapenfrvdyavsreqtnaagermyiqtrmaeykeel
    wellkkdntyvymcglkgmekgiddimvslaekdgidwfdykkqlkrgdqwnvevy