PDB entry 1gao

View 1gao on RCSB PDB site
Description: crystal structure of the l44s mutant of ferredoxin I
Class: electron transport
Keywords: Iron-sulfur clusters, ferredoxin, ELECTRON TRANSPORT
Deposited on 2000-11-30, released 2000-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferredoxin I
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00214
      • engineered (43)
    Domains in SCOPe 2.07: d1gaoa_
  • Chain 'B':
    Compound: ferredoxin I
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00214
      • engineered (43)
    Domains in SCOPe 2.07: d1gaob_
  • Chain 'C':
    Compound: ferredoxin I
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00214
      • engineered (43)
    Domains in SCOPe 2.07: d1gaoc_
  • Chain 'D':
    Compound: ferredoxin I
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00214 (0-105)
      • engineered (43)
    Domains in SCOPe 2.07: d1gaod_
  • Heterogens: SF4, F3S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gaoA (A:)
    afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcascepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gaoB (B:)
    afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcascepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gaoC (C:)
    afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcascepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gaoD (D:)
    afvvtdncikckytdcvevcpvdcfyegpnflvihpdecidcascepecpaqaifsedev
    pedmqefiqlnaelaevwpnitekkdplpdaedwdgvkgklqhler