PDB entry 1gan

View 1gan on RCSB PDB site
Description: complex of toad ovary galectin with n-acetylgalactose
Deposited on 1996-11-06, released 1997-09-04
The last revision prior to the SCOP 1.71 freeze date was dated 1997-09-04, with a file datestamp of 1997-09-04.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: 0.1831
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1gana_
  • Chain 'B':
    Domains in SCOP 1.71: d1ganb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ganA (A:)
    asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv
    cnskeadawgseqregvfpfqqgaevmvcfeyqtdkiiikfssgdqfsfpvrkvlpsipf
    lsleglqfksitte
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ganB (B:)
    asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv
    cnskeadawgseqregvfpfqqgaevmvcfeyqtdkiiikfssgdqfsfpvrkvlpsipf
    lsleglqfksitte