PDB entry 1gan

View 1gan on RCSB PDB site
Description: complex of toad ovary galectin with n-acetylgalactose
Class: s-lectin
Keywords: s-lectin, carbohydrate binding, lectin
Deposited on 1996-11-06, released 1997-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin-1
    Species: Bufo arenarum [TaxId:38577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56217 (0-133)
      • conflict (75)
      • conflict (94)
      • conflict (126)
    Domains in SCOPe 2.08: d1gana_
  • Chain 'B':
    Compound: galectin-1
    Species: Bufo arenarum [TaxId:38577]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56217 (0-133)
      • conflict (75)
      • conflict (94)
      • conflict (126)
    Domains in SCOPe 2.08: d1ganb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ganA (A:)
asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv
cnskeadawgseqregvfpfqqgaevmvcfeyqtdkiiikfssgdqfsfpvrkvlpsipf
lsleglqfksitte

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ganB (B:)
asagvavtnlnlkpghcveikgsippdckgfavnlgedasnfllhfnarfdlhgdvnkiv
cnskeadawgseqregvfpfqqgaevmvcfeyqtdkiiikfssgdqfsfpvrkvlpsipf
lsleglqfksitte