PDB entry 1gal

View 1gal on RCSB PDB site
Description: crystal structure of glucose oxidase from aspergillus niger: refined at 2.3 angstroms resolution
Deposited on 1992-08-27, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.3 Å
R-factor: 0.181
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gal_ (-)
    gieaslltdpkdvsgrtvdyiiagggltglttaarltenpnisvlviesgsyesdrgpii
    edlnaygdifgssvdhayetvelatnnqtalirsgnglggstlvnggtwtrphkaqvdsw
    etvfgnegwnwdnvaayslqaerarapnakqiaaghyfnaschgvngtvhagprdtgddy
    spivkalmsavedrgvptkkdfgcgdphgvsmfpntlhedqvrsdaarewllpnyqrpnl
    qvltgqyvgkvllsqngttpravgvefgthkgnthnvyakhevllaagsavsptileysg
    igmksileplgidtvvdlpvglnlqdqttatvrsritsagagqgqaawfatfnetfgdys
    ekahellntkleqwaeeavarggfhnttalliqyenyrdwivnhnvayselfldtagvas
    fdvwdllpftrgyvhildkdpylhhfaydpqyflneldllgqaaatqlarnisnsgamqt
    yfagetipgdnlaydadlsawteyipyhfrpnyhgvgtcsmmpkemggvvdnaarvygvq
    glrvidgsipptqmsshvmtvfyamalkisdailedyasmq