PDB entry 1gal

View 1gal on RCSB PDB site
Description: crystal structure of glucose oxidase from aspergillus niger: refined at 2.3 angstroms resolution
Class: oxidoreductase(flavoprotein)
Keywords: oxidoreductase(flavoprotein)
Deposited on 1992-08-27, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.181
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucose oxidase
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gala1, d1gala2
  • Heterogens: NAG, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1galA (A:)
    sngieaslltdpkdvsgrtvdyiiagggltglttaarltenpnisvlviesgsyesdrgp
    iiedlnaygdifgssvdhayetvelatnnqtalirsgnglggstlvnggtwtrphkaqvd
    swetvfgnegwnwdnvaayslqaerarapnakqiaaghyfnaschgvngtvhagprdtgd
    dyspivkalmsavedrgvptkkdfgcgdphgvsmfpntlhedqvrsdaarewllpnyqrp
    nlqvltgqyvgkvllsqngttpravgvefgthkgnthnvyakhevllaagsavsptiley
    sgigmksileplgidtvvdlpvglnlqdqttatvrsritsagagqgqaawfatfnetfgd
    ysekahellntkleqwaeeavarggfhnttalliqyenyrdwivnhnvayselfldtagv
    asfdvwdllpftrgyvhildkdpylhhfaydpqyflneldllgqaaatqlarnisnsgam
    qtyfagetipgdnlaydadlsawteyipyhfrpnyhgvgtcsmmpkemggvvdnaarvyg
    vqglrvidgsipptqmsshvmtvfyamalkisdailedyasmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1galA (A:)
    gieaslltdpkdvsgrtvdyiiagggltglttaarltenpnisvlviesgsyesdrgpii
    edlnaygdifgssvdhayetvelatnnqtalirsgnglggstlvnggtwtrphkaqvdsw
    etvfgnegwnwdnvaayslqaerarapnakqiaaghyfnaschgvngtvhagprdtgddy
    spivkalmsavedrgvptkkdfgcgdphgvsmfpntlhedqvrsdaarewllpnyqrpnl
    qvltgqyvgkvllsqngttpravgvefgthkgnthnvyakhevllaagsavsptileysg
    igmksileplgidtvvdlpvglnlqdqttatvrsritsagagqgqaawfatfnetfgdys
    ekahellntkleqwaeeavarggfhnttalliqyenyrdwivnhnvayselfldtagvas
    fdvwdllpftrgyvhildkdpylhhfaydpqyflneldllgqaaatqlarnisnsgamqt
    yfagetipgdnlaydadlsawteyipyhfrpnyhgvgtcsmmpkemggvvdnaarvygvq
    glrvidgsipptqmsshvmtvfyamalkisdailedyasmq