PDB entry 1gag

View 1gag on RCSB PDB site
Description: crystal structure of the insulin receptor kinase in complex with a bisubstrate inhibitor
Class: transferase/transferase inhibitor
Keywords: PROTEIN KINASE INHIBITOR, TYROSINE KINASE, transferase, signaling protein, transferase-transferase inhibitor complex
Deposited on 2000-11-29, released 2001-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.214
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: insulin receptor, tyrosine kinase domain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06213 (Start-305)
      • engineered (3)
      • engineered (6)
      • modified residue (180)
      • modified residue (184)
    Domains in SCOPe 2.07: d1gaga_
  • Chain 'B':
    Compound: bisubstrate peptide inhibitor
    Database cross-references and differences (RAF-indexed):
    • PDB 1GAG (0-12)
  • Heterogens: MG, 112, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gagA (A:)
    vfpssvfvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesas
    lrerieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaen
    npgrppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdi
    yetdyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneq
    vlkfvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsff
    hseenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gagA (A:)
    ssvfvpdewevsrekitllrelgqgsfgmvyegnardiikgeaetrvavktvnesaslre
    rieflneasvmkgftchhvvrllgvvskgqptlvvmelmahgdlksylrslrpeaennpg
    rppptlqemiqmaaeiadgmaylnakkfvhrdlaarncmvahdftvkigdfgmtrdiyet
    dyyrkggkgllpvrwmapeslkdgvfttssdmwsfgvvlweitslaeqpyqglsneqvlk
    fvmdggyldqpdncpervtdlmrmcwqfnpkmrptfleivnllkddlhpsfpevsffhse
    enk
    

  • Chain 'B':
    No sequence available.