PDB entry 1gaf

View 1gaf on RCSB PDB site
Description: 48g7 hybridoma line fab complexed with hapten 5-(para-nitrophenyl phosphonate)-pentanoic acid
Class: catalytic antibody
Keywords: ester hydrolysis, esterolytic, fab, catalytic antibody
Deposited on 1996-02-06, released 1996-07-11
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.244
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: chimeric 48g7 fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1gafh1, d1gafh2
  • Chain 'L':
    Compound: chimeric 48g7 fab
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAD29608 (0-213)
      • conflict (14)
      • conflict (16)
      • conflict (19-20)
      • conflict (23)
      • conflict (27)
      • conflict (30)
      • conflict (33)
      • conflict (35)
      • conflict (40-41)
      • conflict (43)
      • conflict (45)
      • conflict (49)
      • conflict (52)
      • conflict (54-55)
      • conflict (59)
      • conflict (65)
      • conflict (68)
      • conflict (70-72)
      • conflict (78-79)
      • conflict (82)
      • conflict (84)
      • conflict (88)
      • conflict (91-93)
      • conflict (95)
      • conflict (176)
    Domains in SCOPe 2.03: d1gafl1, d1gafl2
  • Heterogens: NPE, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gafH (H:)
    qvqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqrpkqglewigridpanvdtky
    dpkfqdkatitadtsskttylqlssltsedtavyycasyygiywgqgttltvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gafL (L:)
    diqmtqspsslsaslgervsltcrasqeingylgwlqqkpdgtikrliyaastlhsgvpk
    rfsgsrsgsdysltisslesedfadyyclqyasyprtfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec