PDB entry 1gad

View 1gad on RCSB PDB site
Description: comparison of the structures of wild type and a n313t mutant of escherichia coli glyceraldehyde 3-phosphate dehydrogenases: implication for nad binding and cooperativity
Deposited on 1995-10-24, released 1996-03-08
The last revision prior to the SCOP 1.65 freeze date was dated 1996-03-08, with a file datestamp of 1996-03-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.197
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gadO (O:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gadP (P:)
    tikvgingfgrigrivfraaqkrsdieivaindlldadymaymlkydsthgrfdgtvevk
    dghlivngkkirvtaerdpanlkwdevgvdvvaeatglfltdetarkhitagakkvvmtg
    pskdntpmfvkganfdkyagqdivsnascttnclaplakvindnfgiieglmttvhatta
    tqktvdgpshkdwrggrgasqniipsstgaakavgkvlpelngkltgmafrvptpnvsvv
    dltvrlekaatyeqikaavkaaaegemkgvlgyteddvvstdfngevctsvfdakagial
    ndnfvklvswydnetgysnkvldliahisk