PDB entry 1gab

View 1gab on RCSB PDB site
Description: structure of an albumin-binding domain, nmr, 20 structures
Deposited on 1996-12-30, released 1997-07-07
The last revision prior to the SCOP 1.69 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d1gab__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gab_ (-)
    tidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha