PDB entry 1gab

View 1gab on RCSB PDB site
Description: structure of an albumin-binding domain, nmr, 20 structures
Class: albumin-binding protein
Keywords: albumin-binding protein, bacterial surface proteins, evolution, module shuffling
Deposited on 1996-12-30, released 1997-07-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein pab
    Species: Finegoldia magna ATCC 29328 [TaxId:334413]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gaba_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gabA (A:)
    tidqwllknakedaiaelkkagitsdfyfnainkaktveevnalkneilkaha