PDB entry 1ga9

View 1ga9 on RCSB PDB site
Description: crystal structure of ampc beta-lactamase from e. coli complexed with non-beta-lactamase inhibitor (2, 3-(4-benzenesulfonyl-thiophene-2-sulfonylamino)-phenylboronic acid)
Deposited on 2000-11-29, released 2001-07-25
The last revision prior to the SCOP 1.57 freeze date was dated 2001-07-25, with a file datestamp of 2001-07-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.206
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1ga9a_
  • Chain 'B':
    Domains in SCOP 1.57: d1ga9b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ga9A (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ga9B (B:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ga9B (B:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyakkqpvtqqtlfelgsvs
    ktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpdevk
    sssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplklnh
    twinvppaeeknyawgyravhvspgaldaeaygvkstiedmarwvqsnlkpldinektlq
    qgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitpptpavr
    aswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq