PDB entry 1ga8

View 1ga8 on RCSB PDB site
Description: crystal structure of galacosyltransferase lgtc in complex with donor and acceptor sugar analogs.
Deposited on 2000-11-29, released 2001-02-14
The last revision prior to the SCOP 1.69 freeze date was dated 2001-02-14, with a file datestamp of 2001-02-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1ga8a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ga8A (A:)
    mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
    fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
    gdnwlgasidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmssewveqy
    kdvmqyqdqdilnglfkggvcyansrfnfmptnyafmanwfasrhtdplyrdrtntvmpv
    avshycgpakpwhrdctawgaerftelagslttvpeewrgklavphrmfstkrmlqrwrr
    klsarflrkiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ga8A (A:)
    mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
    fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
    gdnwlgasidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmssewveqy
    kdvmqyqdqdilnglfkggvcyansrfnfmptnyafmasrhtdplyrdrtntvmpvavsh
    ycgpakpwhrdctawgaerftelagslttvpeewrgkl