PDB entry 1ga8

View 1ga8 on RCSB PDB site
Description: crystal structure of galacosyltransferase lgtc in complex with donor and acceptor sugar analogs.
Class: transferase
Keywords: alpha-beta protein, transferase
Deposited on 2000-11-29, released 2001-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galactosyl transferase lgtc
    Species: Neisseria meningitidis [TaxId:487]
    Gene: LGTC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P96945 (0-End)
      • modified residue (0)
      • engineered (127)
      • modified residue (144)
      • modified residue (171)
      • engineered (173)
      • modified residue (183)
      • modified residue (209)
      • modified residue (216)
      • modified residue (237)
      • see remark 999 (247)
      • see remark 999 (267)
    Domains in SCOPe 2.07: d1ga8a_
  • Heterogens: DEL, MN, UPF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ga8A (A:)
    mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
    fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
    gdnwlgasidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmssewveqy
    kdvmqyqdqdilnglfkggvcyansrfnfmptnyafmanwfasrhtdplyrdrtntvmpv
    avshycgpakpwhrdctawgaerftelagslttvpeewrgklavphrmfstkrmlqrwrr
    klsarflrkiy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ga8A (A:)
    mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
    fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
    gdnwlgasidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmssewveqy
    kdvmqyqdqdilnglfkggvcyansrfnfmptnyafmasrhtdplyrdrtntvmpvavsh
    ycgpakpwhrdctawgaerftelagslttvpeewrgkl