PDB entry 1ga3

View 1ga3 on RCSB PDB site
Description: nmr structure of interleukin-13
Class: cytokine
Keywords: Interleukin-13,IL-13,IL13,cytokine
Deposited on 2000-11-29, released 2001-07-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-13
    Species: Homo sapiens [TaxId:9606]
    Gene: IL13
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35225 (1-112)
      • cloning artifact (0)
    Domains in SCOPe 2.07: d1ga3a1, d1ga3a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1ga3A (A:)
ggpvppstalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsai
ektqrmlsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregrfn