PDB entry 1ga2

View 1ga2 on RCSB PDB site
Description: the crystal structure of endoglucanase 9g from clostridium cellulolyticum complexed with cellobiose
Class: hydrolase
Keywords: endoglucanase, cellulase 9g, cellobiose complex, cellulose binding domain, (alpha-alpha)6-barrel, hydrolase
Deposited on 2000-11-29, released 2003-07-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoglucanase 9g
    Species: Clostridium cellulolyticum [TaxId:1521]
    Gene: CELCCG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37700 (Start-613)
      • conflict (573-574)
    Domains in SCOPe 2.06: d1ga2a1, d1ga2a2
  • Chain 'B':
    Compound: endoglucanase 9g
    Species: Clostridium cellulolyticum [TaxId:1521]
    Gene: CELCCG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37700 (Start-613)
      • conflict (573-574)
    Domains in SCOPe 2.06: d1ga2b1, d1ga2b2
  • Heterogens: CA, MG, GOL, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ga2A (A:)
    agtynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhv
    kfnlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgd
    ggkdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcis
    haknlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpn
    wgkeqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsy
    tpkglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsf
    vvgygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnne
    iacdynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvy
    nqtgwparvtdkisfkyfmdlseivaagidplslvtssnysegkntkvsgvlpwdvsnnv
    yyvnvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtni
    pvydngvkvfgnep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ga2A (A:)
    ynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhvkfn
    lpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgdggk
    dhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcishak
    nlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpnwgk
    eqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsytpk
    glawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsfvvg
    ygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnneiac
    dynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvynqt
    gwparvtdkisfkyfmdlseivaagidplslvtssnysegkntkvsgvlpwdvsnnvyyv
    nvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtnipvy
    dngvkvfgnep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ga2B (B:)
    agtynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhv
    kfnlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgd
    ggkdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcis
    haknlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpn
    wgkeqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsy
    tpkglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsf
    vvgygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnne
    iacdynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvy
    nqtgwparvtdkisfkyfmdlseivaagidplslvtssnysegkntkvsgvlpwdvsnnv
    yyvnvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtni
    pvydngvkvfgnep
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ga2B (B:)
    gtynygealqksimfyefqrsgdlpadkrdnwrddsgmkdgsdvgvdltggwydagdhvk
    fnlpmsytsamlawslyedkdaydksgqtkyimdgikwandyfikcnptpgvyyyqvgdg
    gkdhswwgpaevmqmerpsfkvdaskpgsavcastaaslasaavvfkssdptyaekcish
    aknlfdmadkaksdagytaasgyyssssfyddlswaavwlylatndstyldkaesyvpnw
    gkeqqtdiiaykwgqcwddvhygaelllakltnkqlykdsiemnldfwttgvngtrvsyt
    pkglawlfqwgslrhattqaflagvyaewegctpskvsvykdflksqidyalgstgrsfv
    vgygvnppqhphhrtahgswtdqmtsptyhrhtiygalvggpdnadgytdeinnyvnnei
    acdynagftgalakmykhsggdpipnfkaiekitndeviikaglnstgpnyteikavvyn
    qtgwparvtdkisfkyfmdlseivaagidplslvtssnysegkntkvsgvlpwdvsnnvy
    yvnvdltgeniypggqsacrrevqfriaapqgttywnpkndfsydglpttstvntvtnip
    vydngvkvfgnep