PDB entry 1g9y

View 1g9y on RCSB PDB site
Description: homing endonuclease i-crei / dna substrate complex with calcium
Deposited on 2000-11-28, released 2001-04-02
The last revision prior to the SCOP 1.71 freeze date was dated 2001-04-02, with a file datestamp of 2001-04-02.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.207
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1g9ya_
  • Chain 'B':
    Domains in SCOP 1.71: d1g9yb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g9yA (A:)
    ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g9yB (B:)
    ntkynkefllylagfvdgdgsiiaqikpnqsykfkhqlsltfqvtqktqrrwfldklvde
    igvgyvrdrgsvsdyilseikplhnfltqlqpflklkqkqanlvlkiieqlpsakespdk
    flevctwvdqiaalndsktrkttsetvravld