PDB entry 1g9r

View 1g9r on RCSB PDB site
Description: crystal structure of galactosyltransferase lgtc in complex with mn and udp-2f-galactose
Deposited on 2000-11-27, released 2001-02-14
The last revision prior to the SCOP 1.55 freeze date was dated 2001-02-14, with a file datestamp of 2001-02-14.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.193
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1g9ra_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g9rA (A:)
    mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
    fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
    gdnwlgasidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmssewveqy
    kdvmqyqdqdilnglfkggvcyansrfnfmptnyafmanwfasrhtdplyrdrtntvmpv
    avshycgpakpwhrdctawgaerftelagslttvpeewrgkl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g9rA (A:)
    mdivfaaddnyaaylcvaaksveaahpdteirfhvldagiseanraavaanlrggggnir
    fidvnpedfagfplnirhisittyarlklgeyiadcdkvlyldidvlvrdsltplwdtdl
    gdnwlgasidlfverqegykqkigmadgeyyfnagvllinlkkwrrhdifkmssewveqy
    kdvmqyqdqdilnglfkggvcyansrfnfmptnyafmasrhtdplyrdrtntvmpvavsh
    ycgpakpwhrdctawgaerftelagslttvpeewrgkl