PDB entry 1g9o

View 1g9o on RCSB PDB site
Description: first pdz domain of the human na+/h+ exchanger regulatory factor
Class: signaling protein
Keywords: PDZ domain, NHERF, COMPLEX, SIGNALING PROTEIN
Deposited on 2000-11-26, released 2001-05-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.181
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nhe-rf
    Species: Homo sapiens [TaxId:9606]
    Gene: NHERF
    Database cross-references and differences (RAF-indexed):
    • Uniprot O14745 (2-90)
      • cloning artifact (0-1)
    Domains in SCOPe 2.05: d1g9oa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g9oA (A:)
    rmlprlcclekgpngygfhlhgekgklgqyirlvepgspaekagllagdrlvevngenve
    kethqqvvsriraalnavrllvvdpetdeql