PDB entry 1g9l

View 1g9l on RCSB PDB site
Description: solution structure of the pabc domain of human poly(a) binding protein
Class: RNA binding protein
Keywords: all-helical domain, RNA BINDING PROTEIN
Deposited on 2000-11-24, released 2001-03-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: polyadenylate-binding protein 1
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P11940 (5-143)
    • cloning artifact (0-4)
  Domains in SCOPe 2.07: d1g9la1, d1g9la2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1g9lA (A:)
  gplgsaaaatpavrtvpqykyaagvrnpqqhlnaqpqvtmqqpavhvqgqepltasmlas
  appqeqkqmlgerlfpliqamhptlagkitgmlleidnsellhmlespeslrskvdeava
  vlqahqakeaaqkavnsatgvptv