PDB entry 1g9l

View 1g9l on RCSB PDB site
Description: solution structure of the pabc domain of human poly(a) binding protein
Class: RNA binding protein
Keywords: all-helical domain, RNA BINDING PROTEIN
Deposited on 2000-11-24, released 2001-03-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: polyadenylate-binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11940 (5-143)
      • cloning artifact (0-4)
    Domains in SCOPe 2.01: d1g9la_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g9lA (A:)
    gplgsaaaatpavrtvpqykyaagvrnpqqhlnaqpqvtmqqpavhvqgqepltasmlas
    appqeqkqmlgerlfpliqamhptlagkitgmlleidnsellhmlespeslrskvdeava
    vlqahqakeaaqkavnsatgvptv