PDB entry 1g9j

View 1g9j on RCSB PDB site
Description: x-tal structure of the mutant e44q of the cellulase cel48f in complex with a thiooligosaccharide
Deposited on 2000-11-24, released 2003-06-24
The last revision prior to the SCOP 1.67 freeze date was dated 2003-06-24, with a file datestamp of 2003-06-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.182
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1g9ja_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g9jA (A:)
    asspankvyqdrfesmyskikdpangyfseqgipyhsietlmvqapdyghvttseamsyy
    mwleamhgrfsgdftgfdkswsvteqyliptekdqpntsmsrydankpatyapefqdpsk
    ypspldtsqpvgrdpinsqltsaygtsmlygmhwildvdnwygfgaradgtskpsyintf
    qrgeqestwetipqpcwdehkfggqygfldlftkdtgtpakqfkytnapdadaravqaty
    wadqwakeqgksvstsvgkatkmgdylrysffdkyfrkigqpsqagtgydaahyllswyy
    awgggidstwswiigsshnhfgyqnpfaawvlstdanfkpkssngasdwaksldrqlefy
    qwlqsaegaiaggatnswngryeavpsgtstfygmgyvenpvyadpgsntwfgmqvwsmq
    rvaelyyktgdarakklldkwakwingeikfnadgtfqipstidwegqpdtwnptqgytg
    nanlhvkvvnygtdlgcasslantltyyaaksgdetsrqnaqklldamwnnysdskgist
    veqrgdyhrfldqevfvpagwtgkmpngdviksgvkfidirskykqdpewqtmvaalqag
    qvptqrlhrfwaqsefavangvyailfpd