PDB entry 1g9i

View 1g9i on RCSB PDB site
Description: crystal structure of beta-trysin complex in cyclohexane
Class: hydrolase/hydrolase inhibitor
Keywords: TRYPSIN-INHIBITOR COMPLEX, ORGANIC MEDIA, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2000-11-24, released 2000-12-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'E':
    Compound: trypsinogen, cationic
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g9ie_
  • Chain 'I':
    Compound: Bowman-Birk type trypsin inhibitor
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01062 (0-21)
      • engineered (7)
      • engineered (15)
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g9iE (E:)
    ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
    neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
    wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
    vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn
    

  • Chain 'I':
    No sequence available.