PDB entry 1g9h

View 1g9h on RCSB PDB site
Description: ternary complex between psychrophilic alpha-amylase, comii (pseudo tri-saccharide from bayer) and tris (2-amino-2-hydroxymethyl-propane-1,3-diol)
Class: hydrolase
Keywords: alpha-beta 8 barrel, 3 domain structure, hydrolase
Deposited on 2000-11-23, released 2002-06-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: alpha-amylase
    Species: Pseudoalteromonas haloplanktis [TaxId:228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1g9ha1, d1g9ha2
  • Heterogens: DAF, BGC, CA, CL, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g9hA (A:)
    tpttfvhlfewnwqdvaqeceqylgpkgyaavqvsppnehitgsqwwtryqpvsyelqsr
    ggnraqfidmvnrcsaagvdiyvdtlinhmaagsgtgtagnsfgnksfpiyspqdfhesc
    tinnsdygndryrvqncelvgladldtasnyvqntiaayindlqaigvkgfrfdaskhva
    asdiqslmakvngspvvfqevidqggeavgaseylstglvtefkystelgntfrngslaw
    lsnfgegwgfmpsssavvfvdnhdnqrghggagnvitfedgrlydlanvfmlaypygypk
    vmssydfhgdtdaggpnvpvhnngnlecfasnwkcehrwsyiaggvdfrnntadnwavtn
    wwdntnnqisfgrgssghmainkedstltatvqtdmasgqycnvlkgelsadakscsgev
    itvnsdgtinlnigawdamaihknakln