PDB entry 1g9g

View 1g9g on RCSB PDB site
Description: xtal-structure of the free native cellulase cel48f
Class: hydrolase
Keywords: Cellulase, processive-endo, HYDROLASE
Deposited on 2000-11-23, released 2003-06-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.165
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellulase cel48f
    Species: Clostridium cellulolyticum [TaxId:1521]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1g9ga_
  • Heterogens: CA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g9gA (A:)
    asspankvyqdrfesmyskikdpangyfseqgipyhsietlmveapdyghvttseamsyy
    mwleamhgrfsgdftgfdkswsvteqyliptekdqpntsmsrydankpatyapefqdpsk
    ypspldtsqpvgrdpinsqltsaygtsmlygmhwildvdnwygfgaradgtskpsyintf
    qrgeqestwetipqpcwdehkfggqygfldlftkdtgtpakqfkytnapdadaravqaty
    wadqwakeqgksvstsvgkatkmgdylrysffdkyfrkigqpsqagtgydaahyllswyy
    awgggidstwswiigsshnhfgyqnpfaawvlstdanfkpkssngasdwaksldrqlefy
    qwlqsaegaiaggatnswngryeavpsgtstfygmgyvenpvyadpgsntwfgmqvwsmq
    rvaelyyktgdarakklldkwakwingeikfnadgtfqipstidwegqpdtwnptqgytg
    nanlhvkvvnygtdlgcasslantltyyaaksgdetsrqnaqklldamwnnysdskgist
    veqrgdyhrfldqevfvpagwtgkmpngdviksgvkfidirskykqdpewqtmvaalqag
    qvptqrlhrfwaqsefavangvyailfpd