PDB entry 1g9f

View 1g9f on RCSB PDB site
Description: crystal structure of the soybean agglutinin in a complex with a biantennary blood group antigen analog
Deposited on 2000-11-23, released 2001-06-13
The last revision prior to the SCOP 1.67 freeze date was dated 2001-06-13, with a file datestamp of 2001-06-13.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1g9fa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1g9fA (A:)
    aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpkpsslgralystpihiw
    dketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenesgdqv
    vavefdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslv
    ypsqrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlphassnid
    pldltsfvlheai
    

    Sequence, based on observed residues (ATOM records): (download)
    >1g9fA (A:)
    aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdtpkpsslgralystpihiwdke
    tgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenesgdqvvav
    efdtfrnswdppnphiginvnsirsikttswdlannkvakvlitydastsllvaslvyps
    qrtsnilsdvvdlktslpewvrigfsaatgldipgeshdvlswsfasnlphldltsfvlh
    e