PDB entry 1g9e

View 1g9e on RCSB PDB site
Description: solution structure and relaxation measurements of an antigen-free heavy chain variable domain (vhh) from llama
Class: immune system
Keywords: beta barrel, immune system
Deposited on 2000-11-23, released 2002-10-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: h14
    Species: LAMA GLAMA [TaxId:9844]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB CAA15406 (0-116)
    Domains in SCOPe 2.07: d1g9ea1, d1g9ea2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1g9eA (A:)
    qvqlqesggglvqaggslrlscaasgrtgstydmgwfrqapgkeresvaainwdsartyy
    assvrgrftisrdnakktvylqmnslkpedtavytcgageggtwdswgqgtqvtvss